PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004509801.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 259aa    MW: 29387.6 Da    PI: 5.3354
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004509801.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26062.79.1e-2011107298
          DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                     C +C+ +rr+ +++C + +yfp +++++f  +  +FG +n+++l++++++++r++a +s++ e++a+   P +G +g  l+l +q++++  el+ 
  XP_004509801.2  11 CLVCRQQRRRHNQECEMGQYFPIDRHEDFDRACYIFGLNNIIRLMQSVEKHQRHAAGNSILLEGRAWRLYPSSGLLGYQLELGSQVSSSLIELQN 105
                     99************************************************************************************999998887 PP

          DUF260  97 lk 98 
                     ++
  XP_004509801.2 106 AN 107
                     65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.0869110IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-1911106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSHRNTRVIE CLVCRQQRRR HNQECEMGQY FPIDRHEDFD RACYIFGLNN IIRLMQSVEK  60
HQRHAAGNSI LLEGRAWRLY PSSGLLGYQL ELGSQVSSSL IELQNANRLL ELCRNHANQD  120
HDESNNPLLS LSLATPSSNP HLSNQLGSSA SQMSSLAITP IEHMGGVETM EAYKINQIMS  180
TRERGESSNT ASNRNTTLQE LQADDKGKQI VVEENESEAT NEEEDSTPME INAEPGDFSV  240
FCFCNLSVHF HYPYIPYAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004509801.20.0PREDICTED: uncharacterized protein LOC101506682
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1630089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G19820.12e-15LOB domain-containing protein 9